PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0064s0028.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 549aa    MW: 62256.9 Da    PI: 5.5242
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0064s0028.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3462.72.7e-141434053353
                          XXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   3 lkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLr 92 
                          l+krmw+d+m++krl+er+k+    ke + g+kk+++s+eq+rrkkmsraQDgiLkYMlk+mevcnaqGfvYgiipe+gkpv+gasd+Lr
  Kalax.0064s0028.1.p  43 LEKRMWRDKMRIKRLRERQKN----KEGDDGSKKQQQSEEQTRRKKMSRAQDGILKYMLKMMEVCNAQGFVYGIIPENGKPVTGASDNLR 128
                          89******************8....66667899********************************************************* PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                 EIN3  93 aWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                          +WWk+ v+fdrngpaai ky  +n i++ + s  +    + ++l+elqDTtlgSLLsalmqhcdppqrrfple+gv+pPWWPtG+e+ww 
  Kalax.0064s0028.1.p 129 EWWKDRVRFDRNGPAAILKYMNDNSIPNPNGSH-MLVGPTTSTLQELQDTTLGSLLSALMQHCDPPQRRFPLERGVAPPWWPTGTEDWWC 217
                          ***************************977777.5599999************************************************* PP

                          HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX..XXXXX CS
                 EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss..slrkq 270
                          +lg++k qg+ppykkphdlkk wkv+vLtavikh++p++++ir+ +rqsk+lqdkm+ake+ ++++v+nqee++++++++ s    +++ 
  Kalax.0064s0028.1.p 218 QLGFPKTQGPPPYKKPHDLKKLWKVGVLTAVIKHIAPNFTKIRKFVRQSKSLQDKMTAKETSTWFAVINQEEAIARELYPPSViaCFNSY 307
                          *********************************************************************************876444445 PP

                          XXXXXXXXXXXXXXX.....XXXXXX.XXXXXXXXXX............XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXX CS
                 EIN3 271 spkvtlsceqkedve.....gkkeskikhvqavktta............gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelif 343
                          +p    ++  ++dv       ++ ++ +h+++ + t+            ++++ +krk+  + + +v  +  ++ c+s q+++ + +l+f
  Kalax.0064s0028.1.p 308 EPFESEDDLGEYDVPlaglfDDQGKNLSHSNTSNLTTdtnytthieapmNLNFLSKRKAAGEVDGSVGRR--VYICDSPQCPYGDIRLGF 395
                          5544555557888889999877777777777777776899******************666666666655..7***************** PP

                          XXXXXXXXXX CS
                 EIN3 344 adknsisqne 353
                          +d+ s+++++
  Kalax.0064s0028.1.p 396 QDRASRDSHQ 405
                          ********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.7E-12442289No hitNo description
Gene3DG3DSA:1.10.3180.101.9E-70165297IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167686.8E-60169292IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MGYDELDFLS GPHAEETMPT LQNESEAILY EDSSDEDIDV DALEKRMWRD KMRIKRLRER  60
QKNKEGDDGS KKQQQSEEQT RRKKMSRAQD GILKYMLKMM EVCNAQGFVY GIIPENGKPV  120
TGASDNLREW WKDRVRFDRN GPAAILKYMN DNSIPNPNGS HMLVGPTTST LQELQDTTLG  180
SLLSALMQHC DPPQRRFPLE RGVAPPWWPT GTEDWWCQLG FPKTQGPPPY KKPHDLKKLW  240
KVGVLTAVIK HIAPNFTKIR KFVRQSKSLQ DKMTAKETST WFAVINQEEA IARELYPPSV  300
IACFNSYEPF ESEDDLGEYD VPLAGLFDDQ GKNLSHSNTS NLTTDTNYTT HIEAPMNLNF  360
LSKRKAAGEV DGSVGRRVYI CDSPQCPYGD IRLGFQDRAS RDSHQLACSF RNCSSSLQNI  420
NYQLKPLVFN PSYLQPASVD NGVVDIRQQV IGSMMSFYDN YVQRDSGQSQ KNSLNQNLVQ  480
APNMSLDNQM LIQDSSQFGH PHLPFESLPD GNNLIMMYSD TQFDPASPDI HGGTLDLISK  540
QDPTTWFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-731672992134Protein ETHYLENE INSENSITIVE 3
4zds_B1e-731672992134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012476376.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X2
RefseqXP_012476375.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like isoform X1
SwissprotQ9SLH01e-175EIL1_ARATH; ETHYLENE INSENSITIVE 3-like 1 protein
TrEMBLA0A0D2R9630.0A0A0D2R963_G
STRINGGLYMA14G04550.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-175ETHYLENE-INSENSITIVE3-like 1